CGRRF1 Peptide - middle region
CGRRF1 Peptide - middle region
Product Specifications
Product Name Alternative
CGR19, RNF197
UniProt
Q99675
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CGRRF1 Rabbit Polyclonal Antibody (orb578705) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_006559
Preservative
Lyophilized powder
AA Sequence
KKDSKEEIYCQLPRDTKIEDFGTVPRSRYPLVALLTLADEDDREIYDIIS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
LC419101 20 µg
Proteasome 20S beta 6 (PSMB6) (NM_002798) Human Over-expression Lysate
Sign In for Pricing
View Details 
BNC042954-500 1x 500 µL
C1QA / Complement C1q A-Chain (C1QA/2954), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680502-500 1x 500 µL
Human Papillomavirus 16 (HPV-16) (CAMVIR-1), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details ![SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]](https://cdn.genprice.uk/products/937/6868c3d8994c49e6dc40081d/imageurl/ta807938bm.webp)
TA807938BM 100 µL
SP110 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2A1]
Sign In for Pricing
View Details 