Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CHTF18 Peptide - middle region

CHTF18 Peptide - middle region

Product Specifications

Product Name Alternative

C16orf41, C321D2.2, C321D2.3, C321D2.4, CHL12, Ctf18, RUVBL

UniProt

Q8WVB6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CHTF18 Rabbit Polyclonal Antibody (orb583625) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_071375

Preservative

Lyophilized powder

AA Sequence

QALLLDALCLLLDILAPKLRPVSTQLYSTREKQQLASLVGTMLAYSLTYR

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTCH1 (NM_000264) Human Tagged ORF Clone
RC216999 10 µg

PTCH1 (NM_000264) Human Tagged ORF Clone

Sign In for Pricing
View Details
Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)
MBS7027366-01 0.02 mg

Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)

Sign In for Pricing
View Details
Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)
MBS7027366-02 0.1 mg

Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)

Sign In for Pricing
View Details
Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)
MBS7027366-03 5x 0.1 mg

Recombinant Daucus carota Photosystem II CP47 chlorophyll apoprotein (psbB)

Sign In for Pricing
View Details
Pleiotrophin (PTN) BioAssayTM ECL ELISA Kit (Rat)
158063 96 Tests

Pleiotrophin (PTN) BioAssayTM ECL ELISA Kit (Rat)

Sign In for Pricing
View Details
Human HSPA8 (+cKO/-) HCT116 Cell Line
ABC-KD7061 1 Vial

Human HSPA8 (+cKO/-) HCT116 Cell Line

Sign In for Pricing
View Details