Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clec1b Peptide - N-terminal region

Clec1b Peptide - N-terminal region

Product Specifications

Product Name Alternative

1810061I13Rik, AI465458, Clec-2, Clec2, mCLEC-2

UniProt

Q9JL99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clec1b Rabbit Polyclonal Antibody (orb580002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064369

Preservative

Lyophilized powder

AA Sequence

MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TOM1L1 Rabbit Polyclonal Antibody
TA382695 100 µL

TOM1L1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Syt14 Mouse Gene Knockout Kit (CRISPR)
KN517081 1 Kit

Syt14 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
S100A4 Polyclonal Antibody
E-AB-40459-01 25 µL

S100A4 Polyclonal Antibody

Sign In for Pricing
View Details
S100A4 Polyclonal Antibody
E-AB-40459-02 100 µL

S100A4 Polyclonal Antibody

Sign In for Pricing
View Details
LMO2 (NM_005574) Human Recombinant Protein
TP305376L 1 mg

LMO2 (NM_005574) Human Recombinant Protein

Sign In for Pricing
View Details
Aceclofenac-d4
TRC-A130401-2.5MG 2.5 mg

Aceclofenac-d4

Sign In for Pricing
View Details