Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Clec1b Peptide - N-terminal region

Clec1b Peptide - N-terminal region

Product Specifications

Product Name Alternative

1810061I13Rik, AI465458, Clec-2, Clec2, mCLEC-2

UniProt

Q9JL99

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Clec1b Rabbit Polyclonal Antibody (orb580002) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_064369

Preservative

Lyophilized powder

AA Sequence

MQDEDGYITLNIKPRKQALSSAEPASSWWRVMALVLLISSMGLVVGLVAL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Adrb3 activation kit by CRISPRa
GA200106 1 Kit

Mouse Adrb3 activation kit by CRISPRa

Sign In for Pricing
View Details
LRRC2 (NM_024512) Human Recombinant Protein
TP316196M 100 µg

LRRC2 (NM_024512) Human Recombinant Protein

Sign In for Pricing
View Details
Zinc
TRC-Z438000-25G 25 g

Zinc

Sign In for Pricing
View Details
CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL
BNCB2166-100 1x 100 µL

CD61 / Integrin 3 / Platelet Glycoprotein IIIa (Platelet Marker) (ITGB3/2166R), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
FES Mouse Monoclonal Antibody [Clone ID: 2E3G3]
AM06182SU-N 100 µL

FES Mouse Monoclonal Antibody [Clone ID: 2E3G3]

Sign In for Pricing
View Details
Benzaldehyde Semicarbazone
TRC-B183930-500MG 500 mg

Benzaldehyde Semicarbazone

Sign In for Pricing
View Details