Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CMA1 Peptide - C-terminal region

CMA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CYH, MCT1, MGC119890, MGC119891, chymase

UniProt

P23946

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CMA1 Rabbit Polyclonal Antibody (orb584539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001827

Preservative

Lyophilized powder

AA Sequence

EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MAP2 Antibody
KC-45629-01 50 μL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 Antibody
KC-45629-02 100 µL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 Antibody
KC-45629-03 1 mL

MAP2 Antibody

Sign In for Pricing
View Details
MAP2 (NM_001039538) Human Over-expression Lysate
LY422067 100 µg

MAP2 (NM_001039538) Human Over-expression Lysate

Sign In for Pricing
View Details
3’-Deoxyguanosine (>90%)
TRC-D242420-50MG 50 mg

3’-Deoxyguanosine (>90%)

Sign In for Pricing
View Details
CFTR Human Gene Knockout Kit (CRISPR)
KN216476RB 1 Kit

CFTR Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details