CMA1 Peptide - C-terminal region
CMA1 Peptide - C-terminal region
Product Specifications
Product Name Alternative
CYH, MCT1, MGC119890, MGC119891, chymase
UniProt
P23946
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with CMA1 Rabbit Polyclonal Antibody (orb584539) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001827
Preservative
Lyophilized powder
AA Sequence
EVKLRLMDPQACSHFRDFDHNLQLCVGNPRKTKSAFKGDSGGPLLCAGVA
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
![prothymosin, alpha (PTMA) Mouse Monoclonal Antibody [Clone ID: 9A10]](https://cdn.genprice.uk/products/937/68dd189e061270361e8fd3fa/imageurl/am32968pu-n.webp)
AM32968PU-N 500 µg
prothymosin, alpha (PTMA) Mouse Monoclonal Antibody [Clone ID: 9A10]
Sign In for Pricing
View Details 
BNC042683-100 1x 100 µL
ERCC1 / RAD10 (Tumor Progression Marker) (ERCC1/2683), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
TP303548 20 µg
ARPM1 (ACTRT3) (NM_032487) Human Recombinant Protein
Sign In for Pricing
View Details 
BNC940172-100 1x 100 µL
CD45 / LCA (135-4C5), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details