Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD8 Peptide - middle region

COMMD8 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20502

UniProt

Q9NX08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060315

Preservative

Lyophilized powder

AA Sequence

IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dusp7 3'UTR GFP Stable Cell Line
TU155465 1.0 mL

Dusp7 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
HorseHigh-Sensitive Lipopolysaccharide binding protein ELISA kit
GTR14673233 96 Well

HorseHigh-Sensitive Lipopolysaccharide binding protein ELISA kit

Sign In for Pricing
View Details
CEP152 Rabbit pAb, AE conjugated
orb2870182 100 µL

CEP152 Rabbit pAb, AE conjugated

Sign In for Pricing
View Details
Beta1-tubulin monoclonal antibody
orb1676947-01 50 µL

Beta1-tubulin monoclonal antibody

Sign In for Pricing
View Details
Beta1-tubulin monoclonal antibody
orb1676947-02 100 µL

Beta1-tubulin monoclonal antibody

Sign In for Pricing
View Details
Beta1-tubulin monoclonal antibody
orb1676947-03 200 µL

Beta1-tubulin monoclonal antibody

Sign In for Pricing
View Details