Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COMMD8 Peptide - middle region

COMMD8 Peptide - middle region

Product Specifications

Product Name Alternative

FLJ20502

UniProt

Q9NX08

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

WB

NCBI Accession Number

NP_060315

Preservative

Lyophilized powder

AA Sequence

IAALRMPLLSLHLDVKENGEVKPYSIEMSREELQNLIQSLEAANKVVLQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Goat chemerin ELI
QY-E140015 96 Tests

Goat chemerin ELI

Sign In for Pricing
View Details
DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, (dinB)
405912-01 20 µg

DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, (dinB)

Sign In for Pricing
View Details
DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, (dinB)
405912-02 100 µg

DNA Polymerase IV, Recombinant, Colwellia Psychrerythraea, aa1-352, (dinB)

Sign In for Pricing
View Details
Olfr860 Protein Vector (Mouse) (pPM-C-HA)
PV211904 500 ng

Olfr860 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6G Antibody
DL21307F-01 20 Tests

PE/Cyanine5.5 Anti-Mouse Ly6G Antibody

Sign In for Pricing
View Details
PE/Cyanine5.5 Anti-Mouse Ly6G Antibody
DL21307F-02 50 Tests

PE/Cyanine5.5 Anti-Mouse Ly6G Antibody

Sign In for Pricing
View Details