Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

COX7B Peptide - N-terminal region

COX7B Peptide - N-terminal region

Product Specifications

UniProt

P24311

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with COX7B Rabbit Polyclonal Antibody (orb581524) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001857

Preservative

Lyophilized powder

AA Sequence

MFPLVKSALNRLQVRSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human PLAC1 (Placenta-specific protein 1) ELISA Kit
EK248876 96 Well

Human PLAC1 (Placenta-specific protein 1) ELISA Kit

Sign In for Pricing
View Details
THAP1 (NM_018105) Human Over-expression Lysate
LY413231 100 µg

THAP1 (NM_018105) Human Over-expression Lysate

Sign In for Pricing
View Details
SERBP1 Polyclonal Antibody, Biotin Conjugated
bs-6734R-Biotin 100 µL

SERBP1 Polyclonal Antibody, Biotin Conjugated

Sign In for Pricing
View Details
HNFβ (TCF-2) Antibody
21658-01 50 µL

HNFβ (TCF-2) Antibody

Sign In for Pricing
View Details
HNFβ (TCF-2) Antibody
21658-02 100 µL

HNFβ (TCF-2) Antibody

Sign In for Pricing
View Details
Rabbit IL18 (Interleukin 18) ELISA Kit
EK242360 96 Well

Rabbit IL18 (Interleukin 18) ELISA Kit

Sign In for Pricing
View Details