Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYM Peptide - N-terminal region

CRYM Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNA40, THBP

UniProt

Q14894

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYM Rabbit Polyclonal Antibody (orb325710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001879

Preservative

Lyophilized powder

AA Sequence

ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human CCNG1 Recombinant Protein
PROTP51959-10ug 10 µg

Human CCNG1 Recombinant Protein

Sign In for Pricing
View Details
alpha 1a Adrenergic Receptor (ADRA1A) (NM_033302) Human Untagged Clone
SC313422 10 µg

alpha 1a Adrenergic Receptor (ADRA1A) (NM_033302) Human Untagged Clone

Sign In for Pricing
View Details
HDAC11 Rabbit Polyclonal Antibody (BF405)
orb2434178 100 µL

HDAC11 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
CD3 zeta antibody (Tyr142)
70R-36086 0.1 mg

CD3 zeta antibody (Tyr142)

Sign In for Pricing
View Details
PRR4 (Proline Rich 4 (lacrimal), DKFZp779L1763, LPRP, PROL4)
250542 100 µg

PRR4 (Proline Rich 4 (lacrimal), DKFZp779L1763, LPRP, PROL4)

Sign In for Pricing
View Details
GNE-317 10mM * 1mL in DMSO
A13992-10mM-D 10 mM x 1mL in DMSO

GNE-317 10mM * 1mL in DMSO

Sign In for Pricing
View Details