Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CRYM Peptide - N-terminal region

CRYM Peptide - N-terminal region

Product Specifications

Product Name Alternative

DFNA40, THBP

UniProt

Q14894

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CRYM Rabbit Polyclonal Antibody (orb325710) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001879

Preservative

Lyophilized powder

AA Sequence

ALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Lepus californicus Cytochrome b (MT-CYB), partial
MBS1015062-01 1 mg (E-Coli)

Recombinant Lepus californicus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
Recombinant Lepus californicus Cytochrome b (MT-CYB), partial
MBS1015062-02 1 mg (Yeast)

Recombinant Lepus californicus Cytochrome b (MT-CYB), partial

Sign In for Pricing
View Details
F (ab') 2 Human IgG F (ab') 2 Antibody Fluorescein Conjugated Pre-Adsorbed
orb348184 1 mg

F (ab') 2 Human IgG F (ab') 2 Antibody Fluorescein Conjugated Pre-Adsorbed

Sign In for Pricing
View Details
Human B7-H3 MAb (Clone 2741E)
MAB10271-100 100 µg

Human B7-H3 MAb (Clone 2741E)

Sign In for Pricing
View Details
NIP1 Antibody (BH3 Domain Specific)
OAAB09461-400UL 400 µL

NIP1 Antibody (BH3 Domain Specific)

Sign In for Pricing
View Details
ELISA Kit for Podocin (PDCN)
TRV-0038615-01 24 Tests

ELISA Kit for Podocin (PDCN)

Sign In for Pricing
View Details