Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST8 Peptide - middle region

CST8 Peptide - middle region

Product Specifications

Product Name Alternative

CRES

UniProt

O60676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CST8 Rabbit Polyclonal Antibody (orb581562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005483

Preservative

Lyophilized powder

AA Sequence

LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Casein kinase 1δ-IN-9
T64376-01 1 mg

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details
Casein kinase 1δ-IN-9
T64376-02 1 mL - 10 mM (in DMSO)

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details
Casein kinase 1δ-IN-9
T64376-03 5 mg

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details
Casein kinase 1δ-IN-9
T64376-04 10 mg

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details
Casein kinase 1δ-IN-9
T64376-05 25 mg

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details
Casein kinase 1δ-IN-9
T64376-06 50 mg

Casein kinase 1δ-IN-9

Sign In for Pricing
View Details