Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CST8 Peptide - middle region

CST8 Peptide - middle region

Product Specifications

Product Name Alternative

CRES

UniProt

O60676

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CST8 Rabbit Polyclonal Antibody (orb581562) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_005483

Preservative

Lyophilized powder

AA Sequence

LKPVNASNANVKQCLWFAMQEYNKESEDKYVFLVVKTLQAQLQVTNLLEY

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Hepatocyte growth factor-regulated tyrosine kinase substrate,HGS ELISA KIT
JOT-EK2131Mo 96 wells

Mouse Hepatocyte growth factor-regulated tyrosine kinase substrate,HGS ELISA KIT

Sign In for Pricing
View Details
FLAP (ALOX5AP) Human qPCR Template Standard (NM_001629)
HK200702 1 Kit

FLAP (ALOX5AP) Human qPCR Template Standard (NM_001629)

Sign In for Pricing
View Details
PE anti-mouse CD19
E16FMP019-200U 200 µg

PE anti-mouse CD19

Sign In for Pricing
View Details
ESPN Protein Vector (Mouse) (pPM-C-His)
PV176373 500 ng

ESPN Protein Vector (Mouse) (pPM-C-His)

Sign In for Pricing
View Details
Adamts15 Mouse siRNA Oligo Duplex (Locus ID 235130)
SR421384 1 Kit

Adamts15 Mouse siRNA Oligo Duplex (Locus ID 235130)

Sign In for Pricing
View Details
Mouse monoclonal PTK7 antibody
MBS5307183-01 0.1 mL

Mouse monoclonal PTK7 antibody

Sign In for Pricing
View Details