Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBL1 Peptide - C-terminal region

CTNNBL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf33, FLJ21108, NAP, NYD-SP19, P14L, PP8304, dJ633O20.1

UniProt

Q8WYA6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTNNBL1 Rabbit Polyclonal Antibody (orb585258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110517

Preservative

Lyophilized powder

AA Sequence

QIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TAPA1 (CD81) Rabbit Polyclonal Antibody
AP31748PU-N 50 µL

TAPA1 (CD81) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD68 Recombinant Chimeric Antibody Antibody
HA610347 100 µL

CD68 Recombinant Chimeric Antibody Antibody

Sign In for Pricing
View Details
AKT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G8]
TA500808BM 100 µL

AKT2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI8G8]

Sign In for Pricing
View Details
BDNF (NM_001709) Human Recombinant Protein
TP762592 50 µg

BDNF (NM_001709) Human Recombinant Protein

Sign In for Pricing
View Details
1-Acenaphthenone
TRC-A130755-5G 5 g

1-Acenaphthenone

Sign In for Pricing
View Details
Frozen Tissue Sections, Urinary bladder
CS645916 5x 5 µm

Frozen Tissue Sections, Urinary bladder

Sign In for Pricing
View Details