Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

CTNNBL1 Peptide - C-terminal region

CTNNBL1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

C20orf33, FLJ21108, NAP, NYD-SP19, P14L, PP8304, dJ633O20.1

UniProt

Q8WYA6

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with CTNNBL1 Rabbit Polyclonal Antibody (orb585258) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_110517

Preservative

Lyophilized powder

AA Sequence

QIRQRVHQILNMRGSSIKIVRHIIKEYAENIGDGRSPEFRENEQKRILGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EBP1 Recombinant Rabbit Monoclonal Antibody [JE35-48]
HA721315 100 µL

EBP1 Recombinant Rabbit Monoclonal Antibody [JE35-48]

Sign In for Pricing
View Details
VGluT1 Recombinant Mouse Monoclonal Antibody [PSH08-34]
HA601371 100 µL

VGluT1 Recombinant Mouse Monoclonal Antibody [PSH08-34]

Sign In for Pricing
View Details
Saliva RNA Collection and Preservation Devices Dx
53800 50 Units

Saliva RNA Collection and Preservation Devices Dx

Sign In for Pricing
View Details
(S)-2-(4-(2-Aminopropyl)phenyl)acetic Acid
TRC-A806650-100MG 100 mg

(S)-2-(4-(2-Aminopropyl)phenyl)acetic Acid

Sign In for Pricing
View Details
Human CORO7-PAM16 activation kit by CRISPRa
GA119365 1 Kit

Human CORO7-PAM16 activation kit by CRISPRa

Sign In for Pricing
View Details
Recombinant RMP/C19orf2 Monoclonal Antibody
AN301683L-01 50 µL

Recombinant RMP/C19orf2 Monoclonal Antibody

Sign In for Pricing
View Details