Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Peptide - C-terminal region

DAP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10

UniProt

P51398

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAP3 Rabbit Polyclonal Antibody (orb331141) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004623

Preservative

Lyophilized powder

AA Sequence

FIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MOBP Adenovirus (Rat)
30290056 1.0 mL

MOBP Adenovirus (Rat)

Sign In for Pricing
View Details
Malaria (pf-HRP-2) Antibody
MBS569634-01 1 mg

Malaria (pf-HRP-2) Antibody

Sign In for Pricing
View Details
Malaria (pf-HRP-2) Antibody
MBS569634-02 5x 1 mg

Malaria (pf-HRP-2) Antibody

Sign In for Pricing
View Details
Glucose 6 phosphate isomerase Recombinant Antibody, HRP Conjugated
bsm-61012R-HRP-TR 20 µL

Glucose 6 phosphate isomerase Recombinant Antibody, HRP Conjugated

Sign In for Pricing
View Details
Mono-Methyl-Histone H4 (K21) Polyclonal Antibody
orb1416075 100 µL

Mono-Methyl-Histone H4 (K21) Polyclonal Antibody

Sign In for Pricing
View Details
[2-Hydroxy-3- (4-nitrophenoxy) propyl] (methyl) amine
IFA22894-01 100 mg

[2-Hydroxy-3- (4-nitrophenoxy) propyl] (methyl) amine

Sign In for Pricing
View Details