Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DAP3 Peptide - C-terminal region

DAP3 Peptide - C-terminal region

Product Specifications

Product Name Alternative

DAP-3, DKFZp686G12159, MGC126058, MGC126059, MRP-S29, MRPS29, bMRP-10

UniProt

P51398

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DAP3 Rabbit Polyclonal Antibody (orb331141) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004623

Preservative

Lyophilized powder

AA Sequence

FIPILVSNYNPKEFESCIQYYLENNWLQHEKAPTEEGKKELLFLSNANPS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CT45A3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated
bs-14092R-BF750 100 µL

CT45A3 Polyclonal Antibody, AbBy Fluor™ 750 Conjugated

Sign In for Pricing
View Details
NPHP1 (Nephrocystin-1, Juvenile Nephronophthisis 1 Protein, NPH1) (MaxLight 490)
130498-ML490 100 µL

NPHP1 (Nephrocystin-1, Juvenile Nephronophthisis 1 Protein, NPH1) (MaxLight 490)

Sign In for Pricing
View Details
Synaptojanin (Synaptojanin 1, Synaptojanin 1 Polyphosphoinositide Phosphatase, Synaptojanin-1, Synj1, Inositol 5'-Phosphatase, INPP5G, KIAA0910, Polyphosphoinositide Phosphatase, Synaptic Inositol-1,4,5-trisphosphate 5-phosphatase 1) discontinued
S9106-70 100 µL

Synaptojanin (Synaptojanin 1, Synaptojanin 1 Polyphosphoinositide Phosphatase, Synaptojanin-1, Synj1, Inositol 5'-Phosphatase, INPP5G, KIAA0910, Polyphosphoinositide Phosphatase, Synaptic Inositol-1,4,5-trisphosphate 5-phosphatase 1) discontinued

Sign In for Pricing
View Details
Rabbit Polyclonal POGZ Antibody
NBP3-29608 100 µg

Rabbit Polyclonal POGZ Antibody

Sign In for Pricing
View Details
6-CR110 Single isomer
TD0062-01 1 mg

6-CR110 Single isomer

Sign In for Pricing
View Details
6-CR110 Single isomer
TD0062-02 5 mg

6-CR110 Single isomer

Sign In for Pricing
View Details