What is the catalog number for Dct Peptide - middle region?

The catalog number for Dct Peptide - middle region is orb2011025.

What sizes are available for Dct Peptide - middle region?

Dct Peptide - middle region is available in the following size(s): 100 µg.

Is Dct Peptide - middle region in stock?

Dct Peptide - middle region is currently made to order / not held in immediate stock. Contact us for lead time.

Dct Peptide - middle region

Product Specifications

Product Name Alternative

DT, TRP-2, TRP2, Tyrp-2, Tyrp2, slaty, slt

UniProt

Q6NXI2

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Tested Applications

IHC, WB

NCBI Accession Number

NP_034154

Preservative

Lyophilized powder

AA Sequence

QHWLGLLGPNGTQPQIANCSVYDFFVWLHYYSVRDTLLGPGRPYKAIDFS

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

30836054 1.0 mL

MTA1 Adenovirus (Mouse)

Sign In for Pricing

View Details

GTR15306087 1 Vial

Lentiviral mouse Usp37 shRNA (UAS) - Lentiviral mouse Usp37 shRNA (UAS, RFP) (100)

Sign In for Pricing

View Details

ELK1837MS-01 48 Tests

Human LIPE (Lipase, Hormone Sensitive) Microsample ELISA Kit

Sign In for Pricing

View Details

ELK1837MS-02 96 Tests

Human LIPE (Lipase, Hormone Sensitive) Microsample ELISA Kit

Sign In for Pricing

View Details

ELK1837MS-03 5x 96 Tests

Human LIPE (Lipase, Hormone Sensitive) Microsample ELISA Kit

Sign In for Pricing

View Details

orb2902711-01 20 µg

Recombinant Rat Syntaxin-1A (Stx1a)

Sign In for Pricing

View Details