Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX51 Peptide - middle region

DDX51 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686N2081, MGC42193

UniProt

Q8N8A6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX51 Rabbit Polyclonal Antibody (orb575998) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778236

Preservative

Lyophilized powder

AA Sequence

FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PRDM1 Human Gene Knockout Kit (CRISPR)
KN217363 1 Kit

PRDM1 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TIE1 (NM_005424) Human Recombinant Protein
TP720418L 500 µg

TIE1 (NM_005424) Human Recombinant Protein

Sign In for Pricing
View Details
QuantiChrom™ Detergent Assay Kit.
DDTR-100 100 Tests

QuantiChrom™ Detergent Assay Kit.

Sign In for Pricing
View Details
Total Amino Acid Microplate Assay Kit
RDSM190 100 Assays

Total Amino Acid Microplate Assay Kit

Sign In for Pricing
View Details
ESD (NM_001984) Human Recombinant Protein
TP720113M 50 µg

ESD (NM_001984) Human Recombinant Protein

Sign In for Pricing
View Details
PRIM1 (NM_000946) Human Over-expression Lysate
LY424441 100 µg

PRIM1 (NM_000946) Human Over-expression Lysate

Sign In for Pricing
View Details