Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DDX51 Peptide - middle region

DDX51 Peptide - middle region

Product Specifications

Product Name Alternative

DKFZp686N2081, MGC42193

UniProt

Q8N8A6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DDX51 Rabbit Polyclonal Antibody (orb575998) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_778236

Preservative

Lyophilized powder

AA Sequence

FNIYTDATPLRVSLVTGQKSLAKEQESLVQKTADGYRCLADIVVATPGRL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

basic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM591]
AM33289PU-T 20 µg

basic Cytokeratin Mouse Monoclonal Antibody [Clone ID: SPM591]

Sign In for Pricing
View Details
KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F6]
TA812140BM 100 µL

KDM3A / JHDM2A (KDM3A) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI9F6]

Sign In for Pricing
View Details
Human CCDC148 activation kit by CRISPRa
GA115132 1 Kit

Human CCDC148 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Lung
CS627086 5x 5 µm

Frozen Tissue Sections, Lung

Sign In for Pricing
View Details
Tissue FFPE Sections, Lung
CS809029 5x 5 µm

Tissue FFPE Sections, Lung

Sign In for Pricing
View Details
HSP27 (Heat Shock Protein 27) (rHSPB1/774), 0.2mg/mL
BNUB2308-100 1x 100 µL

HSP27 (Heat Shock Protein 27) (rHSPB1/774), 0.2mg/mL

Sign In for Pricing
View Details