Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DHX16 Peptide - N-terminal region

DHX16 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DBP2, DDX16, PRO2014, PRP8, PRPF2, Prp2

UniProt

B4DZ28

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DHX16 Rabbit Polyclonal Antibody (orb575926) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001157711

Preservative

Lyophilized powder

AA Sequence

RREYLAKREREKLEDLEAELADEEFLFGDVELSRHERQELKYKRRVRDLA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TBC1D12 (h) -PR
sc-90677-PR 10 µM - 20 µL

TBC1D12 (h) -PR

Sign In for Pricing
View Details
Cytochrome C (CYCS) Antibody
abx008130-01 30 µL

Cytochrome C (CYCS) Antibody

Sign In for Pricing
View Details
Cytochrome C (CYCS) Antibody
abx008130-02 100 µL

Cytochrome C (CYCS) Antibody

Sign In for Pricing
View Details
Cytochrome C (CYCS) Antibody
abx008130-03 200 µL

Cytochrome C (CYCS) Antibody

Sign In for Pricing
View Details
MIRacle™ hsa-miR-125a-5p miRNA Agomir/Antagomir
AM0457 2 OD, 4 OD, 50 OD

MIRacle™ hsa-miR-125a-5p miRNA Agomir/Antagomir

Sign In for Pricing
View Details
S-acetyl-PEG8 alcohol
BIPG1761-01 100 mg

S-acetyl-PEG8 alcohol

Sign In for Pricing
View Details