Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUOXA1 Peptide - C-terminal region

DUOXA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ32334, NIP, NUMBIP, mol

UniProt

A8K9Q6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUOXA1 Rabbit Polyclonal Antibody (orb584930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653166

Preservative

Lyophilized powder

AA Sequence

PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tissue Total RNA, Colon: rectosigmoid
CR562083 5 µg

Tissue Total RNA, Colon: rectosigmoid

Sign In for Pricing
View Details
SUOX (NM_000456) Human Over-expression Lysate
LC424706 20 µg

SUOX (NM_000456) Human Over-expression Lysate

Sign In for Pricing
View Details
C1orf198 (NM_001136495) Human Over-expression Lysate
LC427895 20 µg

C1orf198 (NM_001136495) Human Over-expression Lysate

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-01 50 μL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-02 100 µL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details
SIGLEC7 Antibody (Biotin)
KB-3662-03 1 mL

SIGLEC7 Antibody (Biotin)

Sign In for Pricing
View Details