Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DUOXA1 Peptide - C-terminal region

DUOXA1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

FLJ32334, NIP, NUMBIP, mol

UniProt

A8K9Q6

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DUOXA1 Rabbit Polyclonal Antibody (orb584930) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_653166

Preservative

Lyophilized powder

AA Sequence

PEEGGLLSPRYRSMADSPKSQDIPLSEASSTKAYYRPRRLSLVPADVRGL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KARS Polyclonal Antibody
E-AB-15151-01 20 µL

KARS Polyclonal Antibody

Sign In for Pricing
View Details
KARS Polyclonal Antibody
E-AB-15151-02 60 µL

KARS Polyclonal Antibody

Sign In for Pricing
View Details
KARS Polyclonal Antibody
E-AB-15151-03 120 µL

KARS Polyclonal Antibody

Sign In for Pricing
View Details
KARS Polyclonal Antibody
E-AB-15151-04 200 µL

KARS Polyclonal Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Kidney
CS632506 5x 5 µm

Frozen Tissue Sections, Kidney

Sign In for Pricing
View Details
N2-Cbz-D-glutamine
TRC-C227525-5G 5 g

N2-Cbz-D-glutamine

Sign In for Pricing
View Details