DYNLL1 Peptide - middle region
DYNLL1 Peptide - middle region
Product Specifications
Product Name Alternative
DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, MGC126137, MGC126138, PIN, hdlc1
UniProt
P63167
Field of Research
Cell Biology
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with DYNLL1 Rabbit Polyclonal Antibody (orb581322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_001032583
Preservative
Lyophilized powder
AA Sequence
NIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVA
More Discoveries
Explore Other Products
Browse additional items from our catalog
K1021504 1.0 µg DNA
IFNP20 sgRNA CRISPR Lentivector (Human) (Target 3)
Sign In for Pricing
View Details bsm-62457R-APC-Cy5.5 100 µL
NUDT5 Recombinant Antibody, APC-Cy5.5 Conjugated
Sign In for Pricing
View Details 134189 50 µg
TAF5L (TAF5-like RNA Polymerase II p300/CBP-associated Factor-associated Factor 65kD Subunit 5L, PCAF-associated Factor 65 beta, PAF65-beta, PAF65B)
Sign In for Pricing
View Details