Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

DYNLL1 Peptide - middle region

DYNLL1 Peptide - middle region

Product Specifications

Product Name Alternative

DLC1, DLC8, DNCL1, DNCLC1, LC8, LC8a, MGC126137, MGC126138, PIN, hdlc1

UniProt

P63167

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with DYNLL1 Rabbit Polyclonal Antibody (orb581322) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001032583

Preservative

Lyophilized powder

AA Sequence

NIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVA

More Discoveries

Explore Other Products

Browse additional items from our catalog

FAM89B Human shRNA Plasmid Kit (Locus ID 23625)
TL319734 1 Kit

FAM89B Human shRNA Plasmid Kit (Locus ID 23625)

Sign In for Pricing
View Details
Mouse Gastric triacylglycerol lipase ELISA Kit
MBS9425360-01 96 Tests

Mouse Gastric triacylglycerol lipase ELISA Kit

Sign In for Pricing
View Details
Mouse Gastric triacylglycerol lipase ELISA Kit
MBS9425360-02 5x 96 Tests

Mouse Gastric triacylglycerol lipase ELISA Kit

Sign In for Pricing
View Details
20.5x20.5 cellogel 500µ (10)
EHCA1200-SH20-10 1 Each

20.5x20.5 cellogel 500µ (10)

Sign In for Pricing
View Details
pExpress-1-Dclre1b Plasmid
PVT39145 2 µg

pExpress-1-Dclre1b Plasmid

Sign In for Pricing
View Details
Cleaved-Integrin α7 LC (E959) Antibody
L0285-01 50 μL

Cleaved-Integrin α7 LC (E959) Antibody

Sign In for Pricing
View Details