Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECD Peptide - middle region

ECD Peptide - middle region

Product Specifications

Product Name Alternative

GCR2, HSGT1

UniProt

O95905

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECD Rabbit Polyclonal Antibody (orb324771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009196

Preservative

Lyophilized powder

AA Sequence

VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tmco2 Mouse shRNA Plasmid (Locus ID 69469)
TR518049 1 Kit

Tmco2 Mouse shRNA Plasmid (Locus ID 69469)

Sign In for Pricing
View Details
Kpna6 3'UTR Luciferase Stable Cell Line
TU206836 1.0 mL

Kpna6 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Mouse Monoclonal JAZF1 Antibody (PCRP-JAZF1-1C2) [PerCP]
NBP3-14221PCP 0.1 mL

Mouse Monoclonal JAZF1 Antibody (PCRP-JAZF1-1C2) [PerCP]

Sign In for Pricing
View Details
KLKB1 Antibody
MBS9458477-01 0.05 mL

KLKB1 Antibody

Sign In for Pricing
View Details
KLKB1 Antibody
MBS9458477-02 0.1 mL

KLKB1 Antibody

Sign In for Pricing
View Details
KLKB1 Antibody
MBS9458477-03 5x 0.1 mL

KLKB1 Antibody

Sign In for Pricing
View Details