Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ECD Peptide - middle region

ECD Peptide - middle region

Product Specifications

Product Name Alternative

GCR2, HSGT1

UniProt

O95905

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ECD Rabbit Polyclonal Antibody (orb324771) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_009196

Preservative

Lyophilized powder

AA Sequence

VDVDLNLVSNILESYSSQAGLAGPASNLLQSMGVQLPDNTDHRPTSKPTK

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human MTHFD2 knockdown cell line
ABC-KD9610 1 Vial

Human MTHFD2 knockdown cell line

Sign In for Pricing
View Details
VAMP8 recombinant monoclonal antibody
A5889 100ul X 3

VAMP8 recombinant monoclonal antibody

Sign In for Pricing
View Details
Lentiviral mouse Defb7 shRNA (UAS) - Lentiviral mouse Defb7 shRNA (UAS, GFP) plasmid
GTR15138910 1 Vial

Lentiviral mouse Defb7 shRNA (UAS) - Lentiviral mouse Defb7 shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
GLRX3 (Glutaredoxin 3, GRX3, GRX4, GLRX4, PICOT, TXNL2, TXNL3) (MaxLight 650)
MBS6418617-01 0.1 mL

GLRX3 (Glutaredoxin 3, GRX3, GRX4, GLRX4, PICOT, TXNL2, TXNL3) (MaxLight 650)

Sign In for Pricing
View Details
GLRX3 (Glutaredoxin 3, GRX3, GRX4, GLRX4, PICOT, TXNL2, TXNL3) (MaxLight 650)
MBS6418617-02 5x 0.1 mL

GLRX3 (Glutaredoxin 3, GRX3, GRX4, GLRX4, PICOT, TXNL2, TXNL3) (MaxLight 650)

Sign In for Pricing
View Details
PKHD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
36877154 3x 1.0 µg DNA

PKHD1 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details