EIF4A3 Peptide - N-terminal region
EIF4A3 Peptide - N-terminal region
Product Specifications
Product Name Alternative
DDX48, DKFZp686O16189, KIAA0111, MGC10862, NMP265, NUK34, eIF4AIII
UniProt
P38919
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with EIF4A3 Rabbit Polyclonal Antibody (orb575960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_055555
Preservative
Lyophilized powder
AA Sequence
RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
AP08095PU-N 100 µL
Phospholipase C gamma 1 (PLCG1) Rabbit Polyclonal Antibody
Sign In for Pricing
View Details 
BNC041171-100 1x 100 µL
CD34 (HPCA1/1171), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PKSV030233 100 µg
Recombinant Human RSV (B1) glycoprotein G / RSV-G Protein (His Tag)
Sign In for Pricing
View Details 
E-EL-R1061-01 24 Tests
Rat VCAM-1/CD106 (Vascular Cell Adhesion Molecule 1) ELISA Kit
Sign In for Pricing
View Details E-EL-R1061-02 48 Tests
Rat VCAM-1/CD106 (Vascular Cell Adhesion Molecule 1) ELISA Kit
Sign In for Pricing
View Details E-EL-R1061-03 96 Tests
Rat VCAM-1/CD106 (Vascular Cell Adhesion Molecule 1) ELISA Kit
Sign In for Pricing
View Details