Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF4A3 Peptide - N-terminal region

EIF4A3 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DDX48, DKFZp686O16189, KIAA0111, MGC10862, NMP265, NUK34, eIF4AIII

UniProt

P38919

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF4A3 Rabbit Polyclonal Antibody (orb575960) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055555

Preservative

Lyophilized powder

AA Sequence

RGIYAYGFEKPSAIQQRAIKQIIKGRDVIAQSQSGTGKTATFSISVLQCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PDLIM4 Antibody
KC-3338-01 50 μL

PDLIM4 Antibody

Sign In for Pricing
View Details
PDLIM4 Antibody
KC-3338-02 100 µL

PDLIM4 Antibody

Sign In for Pricing
View Details
PDLIM4 Antibody
KC-3338-03 1 mL

PDLIM4 Antibody

Sign In for Pricing
View Details
SH3MD2 (SH3RF1) (NM_020870) Human Recombinant Protein
TP324916L 1 mg

SH3MD2 (SH3RF1) (NM_020870) Human Recombinant Protein

Sign In for Pricing
View Details
DPM1 (NM_003859) Human Over-expression Lysate
LC401268 20 µg

DPM1 (NM_003859) Human Over-expression Lysate

Sign In for Pricing
View Details
Slc25a29 Mouse Gene Knockout Kit (CRISPR)
KN515975 1 Kit

Slc25a29 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details