Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Peptide - C-terminal region

EIF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2, CAB, EIF3A, ITGB4BP, b, b (2) gcn, gcn, p27BBP, eIF-6, p27 (BBP)

UniProt

P56537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF6 Rabbit Polyclonal Antibody (orb585007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002203

Preservative

Lyophilized powder

AA Sequence

QVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rat Dcp1a Pre-designed siRNA Set B
SI203598B 1 Each

Rat Dcp1a Pre-designed siRNA Set B

Sign In for Pricing
View Details
3-Chloro-2,5-dimethylpyrazine
160508 10 g

3-Chloro-2,5-dimethylpyrazine

Sign In for Pricing
View Details
TRPV6 Rabbit Polyclonal Antibody (APC-Cy5.5)
orb1597903 100 µL

TRPV6 Rabbit Polyclonal Antibody (APC-Cy5.5)

Sign In for Pricing
View Details
Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (FITC) discontinued
S0668-57B-FITC 200 µL

Semaphorin 5A (Semaphorin-F, Sema F, Semaphorin-5A, SEMAF, SEMA5A) (FITC) discontinued

Sign In for Pricing
View Details
Fmoc-D-Ala-OH
BA9317-500000 500 g

Fmoc-D-Ala-OH

Sign In for Pricing
View Details
ZNF280A Antibody (Center)
orb1926154-01 50 µL

ZNF280A Antibody (Center)

Sign In for Pricing
View Details