Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EIF6 Peptide - C-terminal region

EIF6 Peptide - C-terminal region

Product Specifications

Product Name Alternative

2, CAB, EIF3A, ITGB4BP, b, b (2) gcn, gcn, p27BBP, eIF-6, p27 (BBP)

UniProt

P56537

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EIF6 Rabbit Polyclonal Antibody (orb585007) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_002203

Preservative

Lyophilized powder

AA Sequence

QVLVGSYCVFSNQGGLVHPKTSIEDQDELSSLLQVPLVAGTVNRGSEVIA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CXCL1 Rabbit mAb
MBS9148069-01 0.02 mL

CXCL1 Rabbit mAb

Sign In for Pricing
View Details
CXCL1 Rabbit mAb
MBS9148069-02 0.1 mL

CXCL1 Rabbit mAb

Sign In for Pricing
View Details
CXCL1 Rabbit mAb
MBS9148069-03 5x 0.1 mL

CXCL1 Rabbit mAb

Sign In for Pricing
View Details
SP Focurose FF
HL060301500M 500 mL

SP Focurose FF

Sign In for Pricing
View Details
Rabbit Anti-Rat Cholinergic Receptor Nicotinic Alpha 1 (CHRNa1) Polyclonal Antibody
VD2N165 1 Each

Rabbit Anti-Rat Cholinergic Receptor Nicotinic Alpha 1 (CHRNa1) Polyclonal Antibody

Sign In for Pricing
View Details
Recombinant Escherichia coli Uncharacterized fimbrial chaperone yqiH (yqiH)
MBS1223912-01 0.02 mg (E-Coli)

Recombinant Escherichia coli Uncharacterized fimbrial chaperone yqiH (yqiH)

Sign In for Pricing
View Details