Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO1 Peptide - C-terminal region

ELMO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CED-12, CED12, ELMO-1, KIAA0281, MGC126406

UniProt

Q92556

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMO1 Rabbit Polyclonal Antibody (orb331060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055615

Preservative

Lyophilized powder

AA Sequence

TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RNF180 CRISPR Activation Plasmid (h)
sc-415438-ACT 20 µg

RNF180 CRISPR Activation Plasmid (h)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)
MBS2137288-01 0.1 mL

APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)
MBS2137288-02 0.2 mL

APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)
MBS2137288-03 0.5 mL

APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)
MBS2137288-04 1 mL

APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing
View Details
APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)
MBS2137288-05 5 mL

APC_Cy7 Linked Polyclonal Antibody to Parvalbumin (PVALB)

Sign In for Pricing
View Details