Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ELMO1 Peptide - C-terminal region

ELMO1 Peptide - C-terminal region

Product Specifications

Product Name Alternative

CED-12, CED12, ELMO-1, KIAA0281, MGC126406

UniProt

Q92556

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ELMO1 Rabbit Polyclonal Antibody (orb331060) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_055615

Preservative

Lyophilized powder

AA Sequence

TQTPPGMLALDNMLYFAKHHQDAYIRIVLENSSREDKHECPFGRSSIELT

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Leucine Rich Repeat LGI Family Member 3 ELISA Kit
IMSLGI3KT 1 Each

Mouse Leucine Rich Repeat LGI Family Member 3 ELISA Kit

Sign In for Pricing
View Details
METAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)
K1292407 1.0 µg DNA

METAP1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 2)

Sign In for Pricing
View Details
Lyz1 Mouse siRNA Oligo Duplex (Locus ID 17110)
SR403013 1 Kit

Lyz1 Mouse siRNA Oligo Duplex (Locus ID 17110)

Sign In for Pricing
View Details
E/E073/NL534-SA-PholumC-450X150/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)
320547 1 Pack (1 Panel (s) x 1 Pack)

E/E073/NL534-SA-PholumC-450X150/1 Safety & Regulatory Compliance Signs & Labels (Adhesive)

Sign In for Pricing
View Details
MGST2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K1299708 1.0 µg DNA

MGST2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
Rabbit Polyclonal CTR9 Antibody [DyLight 405]
NBP2-97398V 0.1 mL

Rabbit Polyclonal CTR9 Antibody [DyLight 405]

Sign In for Pricing
View Details