Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eno1 Peptide - N-terminal region

Eno1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

Eno1

UniProt

P04764

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eno1 Rabbit Polyclonal Antibody (orb576498) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

AAH90069

Preservative

Lyophilized powder

AA Sequence

YEALELRDNDKTRFMGKGVSKAVEHINKTIAPALVSKKLNVVEQEKIDQL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human CAMK2A / CAMKA Protein (GST tag)
ARP8410-01 10 µg

Recombinant Human CAMK2A / CAMKA Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CAMK2A / CAMKA Protein (GST tag)
ARP8410-02 50 µg

Recombinant Human CAMK2A / CAMKA Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CAMK2A / CAMKA Protein (GST tag)
ARP8410-03 100 µg

Recombinant Human CAMK2A / CAMKA Protein (GST tag)

Sign In for Pricing
View Details
Recombinant Human CAMK2A / CAMKA Protein (GST tag)
ARP8410-04 1 mg

Recombinant Human CAMK2A / CAMKA Protein (GST tag)

Sign In for Pricing
View Details
SAMM50 siRNA (Rat)
orb1829227-01 15 nmol

SAMM50 siRNA (Rat)

Sign In for Pricing
View Details
SAMM50 siRNA (Rat)
orb1829227-02 30 nmol

SAMM50 siRNA (Rat)

Sign In for Pricing
View Details