Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eomes Peptide - C-terminal region

Eomes Peptide - C-terminal region

Product Specifications

Product Name Alternative

C77258, Tbr2, TBR-2

UniProt

O54839

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eomes Rabbit Polyclonal Antibody (orb329904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_034266

Preservative

Lyophilized powder

AA Sequence

SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NT5M (5' (3') -deoxyribonucleotidase, Mitochondrial, 5',3'-nucleotidase, Mitochondrial, Deoxy-5'-nucleotidase 2, dNT-2, DNT2, mdN) (MaxLight 405) discontinued
130596-ML405 100 µL

NT5M (5' (3') -deoxyribonucleotidase, Mitochondrial, 5',3'-nucleotidase, Mitochondrial, Deoxy-5'-nucleotidase 2, dNT-2, DNT2, mdN) (MaxLight 405) discontinued

Sign In for Pricing
View Details
Valemetostat tosylate
MBS3845835-01 5 mg

Valemetostat tosylate

Sign In for Pricing
View Details
Valemetostat tosylate
MBS3845835-02 10 mg

Valemetostat tosylate

Sign In for Pricing
View Details
Valemetostat tosylate
MBS3845835-03 50 mg

Valemetostat tosylate

Sign In for Pricing
View Details
Valemetostat tosylate
MBS3845835-04 100 mg

Valemetostat tosylate

Sign In for Pricing
View Details
Valemetostat tosylate
MBS3845835-05 5x 100 mg

Valemetostat tosylate

Sign In for Pricing
View Details