Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Eomes Peptide - C-terminal region

Eomes Peptide - C-terminal region

Product Specifications

Product Name Alternative

C77258, Tbr2, TBR-2

UniProt

O54839

Field of Research

Immunology & Inflammation

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Eomes Rabbit Polyclonal Antibody (orb329904) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

IHC, WB

NCBI Accession Number

NP_034266

Preservative

Lyophilized powder

AA Sequence

SSDSGVYNSACKRKRLSPSTPSNGNSPPIKCEDINTEEYSKDTSKGMGAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

[Tyr12] Somatostatin 28 (1-14)
orb1980984-01 5 mg

[Tyr12] Somatostatin 28 (1-14)

Sign In for Pricing
View Details
[Tyr12] Somatostatin 28 (1-14)
orb1980984-02 50 mg

[Tyr12] Somatostatin 28 (1-14)

Sign In for Pricing
View Details
Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein
orb1477073-01 20 µg

Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein

Sign In for Pricing
View Details
Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein
orb1477073-02 100 µg

Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein

Sign In for Pricing
View Details
Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein
orb1477073-03 1 mg

Escherichia coli 1,4-dihydroxy-2-naphthoyl-CoA hydrolase Protein

Sign In for Pricing
View Details
Recombinant Shewanella violacea DNA-directed RNA polymerase subunit alpha (rpoA)
MBS1296207-01 0.02 mg (E-Coli)

Recombinant Shewanella violacea DNA-directed RNA polymerase subunit alpha (rpoA)

Sign In for Pricing
View Details