Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erg Peptide - C-terminal region

Erg Peptide - C-terminal region

Product Specifications

Product Name Alternative

D030036I24Rik

UniProt

P81270

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Erg Rabbit Polyclonal Antibody (orb583806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598420

Preservative

Lyophilized powder

AA Sequence

FKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SGCA, ID (SGCA, ADL, DAG2, Alpha-sarcoglycan, 50kD dystrophin-associated glycoprotein, Adhalin, Dystroglycan-2) (MaxLight 650) discontinued
041647-ML650 100 µL

SGCA, ID (SGCA, ADL, DAG2, Alpha-sarcoglycan, 50kD dystrophin-associated glycoprotein, Adhalin, Dystroglycan-2) (MaxLight 650) discontinued

Sign In for Pricing
View Details
Lentiviral human MED29 shRNA (UAS) - Lentiviral human MED29 shRNA (UAS, iRFP) plasmid
GTR15282784 1 Vial

Lentiviral human MED29 shRNA (UAS) - Lentiviral human MED29 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details
Rat Monoclonal CD68/SR-D1 Antibody (FA-11) [CoraFluor 1]
NBP2-33337CL1 0.1 mL

Rat Monoclonal CD68/SR-D1 Antibody (FA-11) [CoraFluor 1]

Sign In for Pricing
View Details
ADAM28 Polyclonal Antibody
bs-22523R 100 µL

ADAM28 Polyclonal Antibody

Sign In for Pricing
View Details
Monkey Chondroitin sulfate synthase 1 (CHSY1) ELISA kit
GTR10415893 96 Well

Monkey Chondroitin sulfate synthase 1 (CHSY1) ELISA kit

Sign In for Pricing
View Details
Phospho-E2F1 (S332) Antibody
E45R05195G-4 50 µL

Phospho-E2F1 (S332) Antibody

Sign In for Pricing
View Details