Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Erg Peptide - C-terminal region

Erg Peptide - C-terminal region

Product Specifications

Product Name Alternative

D030036I24Rik

UniProt

P81270

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Erg Rabbit Polyclonal Antibody (orb583806) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_598420

Preservative

Lyophilized powder

AA Sequence

FKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAY

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SFI1 (AK097004) Human Untagged Clone
SC312641 10 µg

SFI1 (AK097004) Human Untagged Clone

Sign In for Pricing
View Details
CALCB Recombinant Protein (Mouse)
RP120800 100 µg

CALCB Recombinant Protein (Mouse)

Sign In for Pricing
View Details
AHSP (D-12) Alexa Fluor® 594
sc-515436 AF594 200 µg/mL

AHSP (D-12) Alexa Fluor® 594

Sign In for Pricing
View Details
CHGB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
16062154 3x 1.0 µg DNA

CHGB CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Human Peroxiredoxin-4 ELISA Kit
orb1662536 96 Tests

Human Peroxiredoxin-4 ELISA Kit

Sign In for Pricing
View Details
AKAP 95 CRISPR/Cas9 KO Plasmid (h)
sc-403651 20 µg

AKAP 95 CRISPR/Cas9 KO Plasmid (h)

Sign In for Pricing
View Details