Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

ETV1 Peptide - N-terminal region

ETV1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp781L0674, ER81, MGC104699, MGC120533, MGC120534

UniProt

P50549

Field of Research

Cancer Biology

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with ETV1 Rabbit Polyclonal Antibody (orb329615) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_004947

Preservative

Lyophilized powder

AA Sequence

QFVPDYQAESLAFHGLPLKIKKEPHSPCSEISSACSQEQPFKFSYGEKCL

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NAP1L1 (NM_004537) Human Recombinant Protein
TP320821 20 µg

NAP1L1 (NM_004537) Human Recombinant Protein

Sign In for Pricing
View Details
Desmocollin 3 (DSC3) Human Gene Knockout Kit (CRISPR)
KN414959 1 Kit

Desmocollin 3 (DSC3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), 0.2mg/mL
BNUB2809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), 0.2mg/mL

Sign In for Pricing
View Details
6-Deoxy-D-talose
TRC-D275005-10MG 10 mg

6-Deoxy-D-talose

Sign In for Pricing
View Details
Recombinant Cytokeratin-6 Antibody
RC-15801-01 50 μL

Recombinant Cytokeratin-6 Antibody

Sign In for Pricing
View Details
Recombinant Cytokeratin-6 Antibody
RC-15801-02 100 µL

Recombinant Cytokeratin-6 Antibody

Sign In for Pricing
View Details