Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC5 Peptide - N-terminal region

EXOC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp666H126, HSEC10, PRO1912, SEC10, SEC10L1, SEC10P

UniProt

O00471

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC5 Rabbit Polyclonal Antibody (orb581612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006535

Preservative

Lyophilized powder

AA Sequence

ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Tropomodulin 3 Human Recombinant
rAP-3817 1 Each

Tropomodulin 3 Human Recombinant

Sign In for Pricing
View Details
Carbohydrates Kit Type II
88515 1 Kit

Carbohydrates Kit Type II

Sign In for Pricing
View Details
RAB6A Antibody - middle region
OASG06171-100UL 100 µL

RAB6A Antibody - middle region

Sign In for Pricing
View Details
Diphenyl[ (phenylthio) phenyl]sulfonium hexafluorophosphate
JH469840 1 Each

Diphenyl[ (phenylthio) phenyl]sulfonium hexafluorophosphate

Sign In for Pricing
View Details
CKMT1B Antibody - N-terminal region : FITC (ARP67458_P050-FITC)
ARP67458_P050-FITC 100 µL

CKMT1B Antibody - N-terminal region : FITC (ARP67458_P050-FITC)

Sign In for Pricing
View Details
Absinthiin
MBS3607967-01 5 mg

Absinthiin

Sign In for Pricing
View Details