Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

EXOC5 Peptide - N-terminal region

EXOC5 Peptide - N-terminal region

Product Specifications

Product Name Alternative

DKFZp666H126, HSEC10, PRO1912, SEC10, SEC10L1, SEC10P

UniProt

O00471

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with EXOC5 Rabbit Polyclonal Antibody (orb581612) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_006535

Preservative

Lyophilized powder

AA Sequence

ATKVCHLGDQLEGVNTPRQRAVEAQKLMKYFNEFLDGELKSDVFTNSEKI

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ccnd2 ORF Vector (Rat) (pORF)
ORF064570 1.0 µg DNA

Ccnd2 ORF Vector (Rat) (pORF)

Sign In for Pricing
View Details
PIK3C2A, CT (PIK3C2A, Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha) (MaxLight 750)
MBS6333979-01 0.1 mL

PIK3C2A, CT (PIK3C2A, Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha) (MaxLight 750)

Sign In for Pricing
View Details
PIK3C2A, CT (PIK3C2A, Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha) (MaxLight 750)
MBS6333979-02 5x 0.1 mL

PIK3C2A, CT (PIK3C2A, Phosphatidylinositol 4-phosphate 3-kinase C2 domain-containing subunit alpha, Phosphoinositide 3-kinase-C2-alpha) (MaxLight 750)

Sign In for Pricing
View Details
Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody
abx000071-01 50 µL

Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody

Sign In for Pricing
View Details
Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody
abx000071-02 100 µL

Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody

Sign In for Pricing
View Details
Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody
abx000071-03 200 µL

Serine/threonine-Protein Kinase B-Raf (BRAF) Antibody

Sign In for Pricing
View Details