Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

F2R Peptide - C-terminal region

F2R Peptide - C-terminal region

Product Specifications

Product Name Alternative

CF2R, HTR, PAR-1, PAR1, TR

UniProt

P25116

Field of Research

Cardiovascular Research

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with F2R Rabbit Polyclonal Antibody (orb584548) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_001983

Preservative

Lyophilized powder

AA Sequence

YAYYFSAFSAVFFFVPLIISTVCYVSIIRCLSSSAVANRSKKSRALFLSA

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-100 1x 100 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL
BNC400806-100 1x 100 µL

TYRP1 (Tyrosinase Related Protein 1) (TA99), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL
BNC040304-100 1x 100 µL

CD106 / VCAM1 (B-K9), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF740 conjugate, 0.1mg/mL
BNC742818-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (MUC1/2818R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF488A conjugate, 0.1mg/mL
BNC882368-500 1x 500 µL

Cytokeratin 6A (KRT6A) (Basal Cell Marker) (KRT6A/2368), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Bcl-2 (BCL2/782), CF488A conjugate, 0.1mg/mL
BNC880782-500 1x 500 µL

Bcl-2 (BCL2/782), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details