Fam114a2 Peptide - C-terminal region
Fam114a2 Peptide - C-terminal region
Product Specifications
Product Name Alternative
1810073G14Rik, 9030624B09Rik, RP23-206L21.2
UniProt
Q8VE88
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with Fam114a2 Rabbit Polyclonal Antibody (orb581687) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_080618
Preservative
Lyophilized powder
AA Sequence
GVREKADVLNPVITAVFLEASNSASYIQDAFQLLLPVLQISLIESKTESS
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC040096-100 1x 100 µL
Histone H1 (AE-4), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042475-100 1x 100 µL
GLUT-1 (Tumor Progression and Mesothelioma Marker) (GLUT1/2475), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401126-100 1x 100 µL
Arginase 1 (Hepatocellular Carcinoma Marker) (ARG1/1126), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC471880-100 1x 100 µL
Napsin A (Lung Adenocarcinoma Marker) (rNAPSA/1239), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 