Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo32 Peptide - C-terminal region

Fbxo32 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4833442G10Rik, AI430017, ATROGIN1, MAFbx, atrogin-1, Gm20361

UniProt

Q9CPU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo32 Rabbit Polyclonal Antibody (orb330701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080622

Preservative

Lyophilized powder

AA Sequence

LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Horseradish Peroxidase
22060223-1 20 mg

Horseradish Peroxidase

Sign In for Pricing
View Details
Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS066143-01 48 Well

Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details
Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS066143-02 96 Well

Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details
Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS066143-03 5x 96 Well

Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details
Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit
MBS066143-04 10x 96 Well

Horse Inducible T-Cell Co Stimulator Ligand ELISA Kit

Sign In for Pricing
View Details
Fluor® Red 780 Anti-Mouse CD25 Antibody[PC-61.5.3]
FCE2372-01 50 Tests

Fluor® Red 780 Anti-Mouse CD25 Antibody[PC-61.5.3]

Sign In for Pricing
View Details