Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Fbxo32 Peptide - C-terminal region

Fbxo32 Peptide - C-terminal region

Product Specifications

Product Name Alternative

4833442G10Rik, AI430017, ATROGIN1, MAFbx, atrogin-1, Gm20361

UniProt

Q9CPU7

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with Fbxo32 Rabbit Polyclonal Antibody (orb330701) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_080622

Preservative

Lyophilized powder

AA Sequence

LVRCYPRREQYGVTLQLCKHCHILSWKGTDHPCTANNPESCSVSLSPQDF

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DNASE1 Rabbit Polyclonal Antibody
53873-01 50 µL

DNASE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
DNASE1 Rabbit Polyclonal Antibody
53873-02 100 µL

DNASE1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
LIMK2 (LIM Domain Kinase 2, LIMK-2) (MaxLight 650)
MBS6384243-01 0.1 mL

LIMK2 (LIM Domain Kinase 2, LIMK-2) (MaxLight 650)

Sign In for Pricing
View Details
LIMK2 (LIM Domain Kinase 2, LIMK-2) (MaxLight 650)
MBS6384243-02 5x 0.1 mL

LIMK2 (LIM Domain Kinase 2, LIMK-2) (MaxLight 650)

Sign In for Pricing
View Details
Anti-Cd19 Antibody , Cy3 Conjugate
A00154-4-Cy3 100 µg/Vial

Anti-Cd19 Antibody , Cy3 Conjugate

Sign In for Pricing
View Details
Rabbit Anti-CXXC5 antibody
SL6890R-01 50 µL

Rabbit Anti-CXXC5 antibody

Sign In for Pricing
View Details