Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FGF13 Peptide - middle region

FGF13 Peptide - middle region

Product Specifications

Product Name Alternative

FGF2, FHF-2, FHF2, FGF-13

UniProt

Q92913

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FGF13 Rabbit Polyclonal Antibody (orb582750) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_378668

Preservative

Lyophilized powder

AA Sequence

PKPLKVAMYKEPSLHDLTEFSRSGSGTPTKSRSVSGVLNGGKSMSHNEST

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MTBP Polyclonal Antibody
RD265898A-01 60 μL

MTBP Polyclonal Antibody

Sign In for Pricing
View Details
MTBP Polyclonal Antibody
RD265898A-02 120 μL

MTBP Polyclonal Antibody

Sign In for Pricing
View Details
MTBP Polyclonal Antibody
RD265898A-03 200 µL

MTBP Polyclonal Antibody

Sign In for Pricing
View Details
APOC2 Rabbit pAb
E45R23928N-100 100 µL

APOC2 Rabbit pAb

Sign In for Pricing
View Details
FAF1 Antibody
orb2676229-01 50 µL

FAF1 Antibody

Sign In for Pricing
View Details
FAF1 Antibody
orb2676229-02 100 µL

FAF1 Antibody

Sign In for Pricing
View Details