Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FTSJD1 Peptide - middle region

FTSJD1 Peptide - middle region

Product Specifications

Product Name Alternative

AFT, FTSJD1

UniProt

Q8IYT2

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FTSJD1 Rabbit Polyclonal Antibody (orb326163) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_060818

Preservative

Lyophilized powder

AA Sequence

LMYLLNCCFDQVHVFKPATSKAGNSEVYVVCLHYKGREAIHPLLSKMTLN

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CDX2 Antibody
KC-151-01 50 μL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-151-02 100 µL

CDX2 Antibody

Sign In for Pricing
View Details
CDX2 Antibody
KC-151-03 1 mL

CDX2 Antibody

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997M1-01 50 Tests

Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997M1-02 100 Tests

Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details
Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]
E-AB-F0997M1-03 2x 100 Tests

Elab Fluor® 700 Anti-Mouse CD16/32 Antibody[2.4G2]

Sign In for Pricing
View Details