Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXH1 Peptide - N-terminal region

FOXH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST-1, FAST1

UniProt

O75593

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXH1 Rabbit Polyclonal Antibody (orb576664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003914

Preservative

Lyophilized powder

AA Sequence

MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

B7 H6 (NCR3LG1) Rabbit Monoclonal Antibody [Clone ID: 17B1.3]
TA386389 200 µg

B7 H6 (NCR3LG1) Rabbit Monoclonal Antibody [Clone ID: 17B1.3]

Sign In for Pricing
View Details
Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate
LC431501 20 µg

Twinkle (TWNK) (NM_001163812) Human Over-expression Lysate

Sign In for Pricing
View Details
GTF3A (NM_002097) Human Over-expression Lysate
LY429087 100 µg

GTF3A (NM_002097) Human Over-expression Lysate

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7982-01 50 μL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7982-02 100 µL

DNAJB1 Antibody

Sign In for Pricing
View Details
DNAJB1 Antibody
KC-7982-03 1 mL

DNAJB1 Antibody

Sign In for Pricing
View Details