Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

FOXH1 Peptide - N-terminal region

FOXH1 Peptide - N-terminal region

Product Specifications

Product Name Alternative

FAST-1, FAST1

UniProt

O75593

Form

Lyophilized powder

Storage Conditions

Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.

Notes

For research use only.

Applications Notes

This is a synthetic peptide designed for use in combination with FOXH1 Rabbit Polyclonal Antibody (orb576664) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.

Tested Applications

WB

NCBI Accession Number

NP_003914

Preservative

Lyophilized powder

AA Sequence

MGPCSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAP

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUX4L6 Human Gene Knockout Kit (CRISPR)
KN425828 1 Kit

DUX4L6 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF740 conjugate, 0.1mg/mL
BNC741937-500 1x 500 µL

Vimentin (Mesenchymal Cell Marker) (VIM/1937R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Recombinant COPS3 Monoclonal Antibody
AN301497L-01 50 µL

Recombinant COPS3 Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant COPS3 Monoclonal Antibody
AN301497L-02 100 µL

Recombinant COPS3 Monoclonal Antibody

Sign In for Pricing
View Details
CD8A (C-term) Mouse Monoclonal Antibody [Clone ID: C8/144B]
AM10073PU-S 100 µg

CD8A (C-term) Mouse Monoclonal Antibody [Clone ID: C8/144B]

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS506014 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details