FOXN2 Peptide - middle region
FOXN2 Peptide - middle region
Product Specifications
Product Name Alternative
HTLF
UniProt
P32314
Form
Lyophilized powder
Storage Conditions
Add 100ul of sterile PBS. Final peptide concentration is 1 mg/ml in PBS. For longer periods of storage, store at -2°C. Avoid repeat freeze-thaw cycles.
Notes
For research use only.
Applications Notes
This is a synthetic peptide designed for use in combination with FOXN2 Rabbit Polyclonal Antibody (orb574316) . It may block above mentioned antibody from binding to its target protein in western blot and/or immunohistochecmistry under proper experimental settings.
Tested Applications
WB
NCBI Accession Number
NP_002149
Preservative
Lyophilized powder
AA Sequence
LIQALKKQPFSSASSQNGSLSPHYLSSVIKQNQVRNLKESDIDAAAAMML
More Discoveries
Explore Other Products
Browse additional items from our catalog
OR1032307-01 100 mg
5-Bromo-2- (piperidin-4-yl) thiazole hydrochloride
Sign In for Pricing
View Details OR1032307-02 250 mg
5-Bromo-2- (piperidin-4-yl) thiazole hydrochloride
Sign In for Pricing
View Details OR1032307-03 1 g
5-Bromo-2- (piperidin-4-yl) thiazole hydrochloride
Sign In for Pricing
View Details 
ARP73610_P050 100 µL
CCDC82 Antibody - C-terminal region (ARP73610_P050)
Sign In for Pricing
View Details VD3N64 1 Each
Rabbit Anti-Mouse Puromycin Sensitive Aminopeptidase (PSA) Polyclonal Antibody
Sign In for Pricing
View Details 036765-APC 200 µL
HRH4, ID (HRH4, GPCR105, Histamine H4 receptor, AXOR35, G-protein coupled receptor 105, GPRv53, Pfi-013, SP9144) (APC)
Sign In for Pricing
View Details